Protein Info for CCNA_01325 in Caulobacter crescentus NA1000

Annotation: LSU ribosomal protein L15P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR01071: ribosomal protein uL15" amino acids 3 to 149 (147 residues), 151.5 bits, see alignment E=7e-49 PF00828: Ribosomal_L27A" amino acids 76 to 150 (75 residues), 68.5 bits, see alignment E=2.7e-23

Best Hits

Swiss-Prot: 100% identical to RL15_CAUVN: 50S ribosomal protein L15 (rplO) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 100% identity to ccr:CC_1267)

Predicted SEED Role

"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H4F3 at UniProt or InterPro

Protein Sequence (161 amino acids)

>CCNA_01325 LSU ribosomal protein L15P (Caulobacter crescentus NA1000)
MTKLNELAPREGSTKGRMRVGRGPGSGKGKTAGRGVKGQKARSGVAINGFEGGQMPLHMR
MPKRGFNNPFRLEFAEVNLWRLEQAVEAGKIKKGAELDAAALIAAGVIRRELDGVKLLAK
GEIKTALKLTVYSATEAAIKAVEAAGGSVTVTKKAKAQAEA