Protein Info for CCNA_01289 in Caulobacter crescentus NA1000

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details PF04241: DUF423" amino acids 23 to 105 (83 residues), 80.7 bits, see alignment E=3.8e-27

Best Hits

Swiss-Prot: 49% identical to YWDK_BACSU: UPF0382 membrane protein YwdK (ywdK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01289)

Predicted SEED Role

"COG2363"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7L4 at UniProt or InterPro

Protein Sequence (125 amino acids)

>CCNA_01289 hypothetical protein (Caulobacter crescentus NA1000)
MEGWTPRTWTGLAAANGLLAVAFGAFAAHGIDGWKAVEWLKTGAQYQMIHALAVFAAFTL
HKAGAKSMGIVTALFFVGILLFSGSLYAMALGAPRILGAITPLGGLSFIAGWALMAWRGF
NQPQA