Protein Info for CCNA_01251 in Caulobacter crescentus NA1000

Annotation: FepC-type transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 36% identical to HMUV_RUEST: Hemin import ATP-binding protein HmuV (hmuV) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to ccs:CCNA_01251)

Predicted SEED Role

"Vitamin B12 ABC transporter, ATPase component BtuD" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7H8 at UniProt or InterPro

Protein Sequence (252 amino acids)

>CCNA_01251 FepC-type transporter protein (Caulobacter crescentus NA1000)
MSALWTLKDLSARQGRKTVLQAASLSVSAGEVVGVVGPNGAGKTSLLRAGLGLLPAGSGE
AHLSGLAVADLAPAPRTRLVGYMPQERRVAWNVPARMVAALGASDLPDAEADAVALDCLQ
RVGAADLADRGVLDMSGGERARVLLARLLATRAPLLVADEPVAGLDPDAQLLTLDLLRSE
AQRGGAVVVTLHDLSLAARSCDRVVVVSGGRIVADAPPRDALSRAVLAEVFGLDGVLIDT
EAGPVLAARRRA