Protein Info for CCNA_01230 in Caulobacter crescentus NA1000

Annotation: arylsulfatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00884: Sulfatase" amino acids 63 to 425 (363 residues), 192.2 bits, see alignment E=2e-60 PF01663: Phosphodiest" amino acids 326 to 365 (40 residues), 26 bits, see alignment 1.1e-09 PF16347: SGSH_C" amino acids 381 to 516 (136 residues), 30.3 bits, see alignment E=6.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01230)

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7G1 at UniProt or InterPro

Protein Sequence (551 amino acids)

>CCNA_01230 arylsulfatase family protein (Caulobacter crescentus NA1000)
MKAWKPLVAGVAVLAVAGATAWHFRFDLIVMLAKARQPKIEANMPVTWAKGPQAPPADGQ
RPPNIVFILADDLGYNDITLNGGGVAGGTVPTPAIDSIAKEGVTFANGYSGNATCAPSRA
AIMTGRYATRFGFEFTPTPVAFSRVVGGHAGDPLHPSRFNQAEVKNMPKDENVLAVPAAE
VTIAEALKTKGYHTIHLGKWHLGGVKGSRPEDQGFDESLGFMAGAALFAPVGDPGVVESR
QDWDPIDKFLWGAAPFAVQFNGGKLFNPSHYMTDYLTDEAVKAIDANKNRPFFMYLAYNA
VHTPLQAPKADYDALSHIKDHRMRVYAAMVRNLDRNVGKVLQALKDRGLDDNTLVIFTSD
NGGANYIGLPDINKPYRGWKATFFEGGIKVPFLLRWPEQLPAGAVYRSPVGHVDIFATAA
GAAGAPTPKDRVLDGVDLVPFVKGQSSGDPHKAIFWRSGGYKTVLAGGWKLQVAKEPNKT
WLFDLSTDPTERQELSKARPEKLREMQAIMAQLDGQMMKPTWPSLISGAFYIDHPGGQKA
KPSDEYIYWEN