Protein Info for CCNA_01196 in Caulobacter crescentus NA1000

Annotation: iron-regulated outer membrane virulence protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 PF07715: Plug" amino acids 40 to 135 (96 residues), 38.9 bits, see alignment E=1.1e-13 PF00593: TonB_dep_Rec_b-barrel" amino acids 188 to 628 (441 residues), 101.7 bits, see alignment E=9e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01196)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8V7 at UniProt or InterPro

Protein Sequence (659 amino acids)

>CCNA_01196 iron-regulated outer membrane virulence protein (Caulobacter crescentus NA1000)
MPFDVPPASVAPVVVEAPRLPPLVGQEAFSTARYDAEALSAANRLDVVLKATPGVSLFRR
TGSDAANPTIQGLSLRGVAPSGAGRALVTLDGAPQNDPFGGWVIWTALPGEGLSGATIVR
GAGAGPYGAGALTGVVALRERAAGGGLSSLNAQVGARDSWRAAGTFGTDHLLLTASGSRT
DGYDPVRDARRGAADTPTTLEDGSVAVRLQGSLTSVRWALRAGAYQERRDAGLVGARSNA
TGGSLALTLADDAWRLQAWARRSDLENSSVAVAAGRVSTTPANDQFSTPATGYGLNAAWQ
GRQGGWAWELGGDVRATEGRVNERFRYQSGAFTRVREAGGRTLVGGLYAETALAREDVSL
TFGARLDGWRSYAGVRRERDALTGAATLDAPISDASGATPTARAGLRQRLKGDTWWRAAA
YAGFRPPTLNELHRPFRVGNDVTEANAALKPETLYGLETGLVGEGTVRWSLAAFYNQVQD
PITNVTIGAGPGSFPVAGFIPAGGVLRQRRNVGEINAYGVEGDVELDLTSAWALRGAVSW
THARVDGARGAPQLTGKRPAQAPAVTVTAGTRWRPIERLSLDAALRYEGLRYEDDLNLRR
LKAGAGLDVRAAWRLTPASEIYVAADNVLNHDLAVGQTADGVTSYAAPRTVFVGFALRR