Protein Info for CCNA_01194 in Caulobacter crescentus NA1000

Updated annotation (from data): TonB-dependent receptor for sucrose and raffinose (SucA)
Rationale: Specific phenotype: utilization of D-Raffinose. Raffinose is probably cleaved in the cytoplasm by CCNA_02368, implying raffinose transport. This also transports sucrose (PMID:30054816)
Original annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 817 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07715: Plug" amino acids 52 to 165 (114 residues), 56.9 bits, see alignment E=2.7e-19 PF00593: TonB_dep_Rec_b-barrel" amino acids 364 to 777 (414 residues), 81.9 bits, see alignment E=9.1e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01194)

Predicted SEED Role

"Predicted sucrose-specific TonB-dependent receptor" in subsystem Sucrose utilization or Sucrose utilization Shewanella

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7C3 at UniProt or InterPro

Protein Sequence (817 amino acids)

>CCNA_01194 TonB-dependent receptor for sucrose and raffinose (SucA) (Caulobacter crescentus NA1000)
MNRQKSRLLVGAAVLAMLPLAAHAQQSVTKNDQDVLELDAVVITASRDGATKMNSSISVS
ALSADQILAQAPRSTAEIFRGLPGVRSEATGGDGNANIAVRGLPVASGGAKFLQLQEDGL
PVMEFGDIAFGNADIFLRADQNVARIESVRGGSSSTFASNSPGGVINFISKTGEVEGGEI
ALTKGLGYDHTRLDFDYGAPLSDTLRFHVGGFYREGEGARKSGYTSEKGGQIKANLTKDF
ENGFIRLNVKYLNDRAVGYLPMPTRVTGSNGDPDIGSFAGYDIGRDDLQSIYLARNPGLD
GDGNRRISKVADGMHPDTLQFGAEAKFDIGGWKIEDRFKVAKTSGRFVAPFPAEVLSAQA
LATSIGGAGATLRYANGPSAGQAITAPGSLNGNGLAMRIHMFDVEINDFGNAMNDLKLSR
SFDTGAAVVDVTVGYYKSRQTIAMDWLWNTFVSEVKGDNAALLDVYNSAGTKLTQTGLAA
YGVPLWGNCCTRRYDVTYDIDAPYLSLSSRIGDLSLDASLRRDEGKARGLYAGAKQAAVD
VNGDGVIQNVEQSVSVIDNANASPVNYDWGYTSWSLGANYQFNPDVAAFARVSRGGRANA
DRLLFGKVRADGTVSKEDAVDMVDQVEGGVKYRRAGFGLFATAFWARTQEQNFEATSQRF
FDRTYKAKGIELEASYRIGDFSVTGGATYTDAVIDKDALTPAVVGNAPRRQAKWIYQFAP
TWTINDKATIGASVIGTTKAYAQDDNQLIFPAYAQVNAFAEYKLAETLSLSVNANNLFDK
VGLTEAEEGSITAGSVNAIRARSINGRTVTATLRYSF