Protein Info for CCNA_01187 in Caulobacter crescentus NA1000

Annotation: RNA polymerase ECF-type sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF04542: Sigma70_r2" amino acids 25 to 87 (63 residues), 32.1 bits, see alignment E=1.2e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 170 (146 residues), 68.2 bits, see alignment E=3.4e-23 PF08281: Sigma70_r4_2" amino acids 118 to 167 (50 residues), 48.4 bits, see alignment E=8.9e-17 PF04545: Sigma70_r4" amino acids 120 to 168 (49 residues), 26.9 bits, see alignment E=4.3e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to ccs:CCNA_01187)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5W0 at UniProt or InterPro

Protein Sequence (183 amino acids)

>CCNA_01187 RNA polymerase ECF-type sigma factor (Caulobacter crescentus NA1000)
MADIARRLPGPGTAEMSDLASLRAQRRDLYQFIVRRTRDPATAEDLVQETFERLLAYGQA
KTIVDRAALGYGIALNLVRDHFRLAQRRAFQALDDDIPCPDPAPEQILMHRQKVEVFSQV
LDAMPPLRRDVFIRRRLHGHSSRQISKDLSLSEAAVEKHVARALEQLRREVARAERRAGG
GRS