Protein Info for CCNA_01131 in Caulobacter crescentus NA1000

Annotation: flagellar biosynthesis protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details PF01312: Bac_export_2" amino acids 8 to 348 (341 residues), 409.5 bits, see alignment E=6.1e-127 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 354 (347 residues), 439.8 bits, see alignment E=3.8e-136

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to ccs:CCNA_01131)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7D6 at UniProt or InterPro

Protein Sequence (361 amino acids)

>CCNA_01131 flagellar biosynthesis protein FlhB (Caulobacter crescentus NA1000)
MADDTDPESKTEEPSAKKLSDARAKGDVIKSADIPQLASLAGAVSVILLAGGWLTRDLMA
ALTPFIAHAGTIDLSSGGAMIVLKQALLAALPALVLVMVVTAFAGAAAHIAQTGFLLTPE
KIKPDFQKLDLIKGLGRIFGPDGMVQFLKSAVKFLLTGVIAYFVLKPHVGEVRNLVGMDP
AAMIPEAMKLSKGLLIAVILLLVATSAFDYFWQRMRFMNRMRMTLQEVKEEFKQSDGDPH
IKGKRRQIQMQRSRQRMMQAVPKATVVVMNPTHYAVALKYEQGETPAPLCVAKGVDDLAL
KIRAVAEEHGVPVLEDPPLARALYASVEIDEEIPVEHFEAVAKVISFILNGKKPQPRARP
L