Protein Info for CCNA_00978 in Caulobacter crescentus NA1000

Annotation: transposase, DDE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 105 to 121 (17 residues), see Phobius details PF01609: DDE_Tnp_1" amino acids 3 to 120 (118 residues), 46.7 bits, see alignment E=3.4e-16 PF13586: DDE_Tnp_1_2" amino acids 37 to 122 (86 residues), 35.3 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 46% identical to T6501_BRUO2: Putative transposase for insertion sequence element IS6501 (BOV_0130) from Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01350)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C949 at UniProt or InterPro

Protein Sequence (122 amino acids)

>CCNA_00978 transposase, DDE family (Caulobacter crescentus NA1000)
MAVRGLGCPVRFSLTAGQKGDAPQAAALIEGLPAKVVMADTAYDADHLRQAIADKGALAV
IPNNPSRALKHPLDAQLYAQRHLVECCFSKLKQFRRVATRFEKTARNYLAVVTLAAIALW
LR