Protein Info for CCNA_00883 in Caulobacter crescentus NA1000

Annotation: 3-demethylubiquinone 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 18 to 246 (229 residues), 277.9 bits, E=2.6e-87
• PF01209: Ubie_methyltran
  • amino acids 65 to 173 (109 residues), 28.5 bits, E=3.5e-10
• PF13489: Methyltransf_23
  • amino acids 66 to 181 (116 residues), 80.8 bits, E=3.4e-26
• PF13847: Methyltransf_31
  • amino acids 68 to 183 (116 residues), 63.3 bits, E=8e-21
• PF02353: CMAS
  • amino acids 68 to 195 (128 residues), 35.5 bits, E=2.5e-12
• PF08241: Methyltransf_11
  • amino acids 73 to 168 (96 residues), 79.9 bits, E=6.2e-26
• PF08242: Methyltransf_12
  • amino acids 73 to 166 (94 residues), 65.5 bits, E=2.1e-21
• PF13649: Methyltransf_25
  • amino acids 73 to 165 (93 residues), 67.4 bits, E=5.4e-22

Best Hits

Swiss-Prot: 100% identical to UBIG_CAUVN: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to ccr:CC_0840)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.64

Sequence Analysis Tools

See B8H209 at UniProt or InterPro

Protein Sequence (252 amino acids)

>CCNA_00883 3-demethylubiquinone 3-methyltransferase (Caulobacter crescentus NA1000)
MTQAASAAPSWSIDPADVARFSAIAAEWWDPKGKFAPLHVFNPCRLAFIREQALARFDRD
GAARAPFEGLTLLDIGCGGGLLSEPMARLGFAVTAIDASEKNIKTAATHAAEQGLDIGYR
PATAEQLLAEGAGPFDVVLTMEVIEHVADPGEFLRTCAKLLKPGGIMFVATLNRTLKALA
LAKIGAEYVLRWVPPGTHDWKQFLKPEELRAFLAGEPVAMQGPFGVAYNPLTGRWSRSSD
TDINYMMTVTKD