Protein Info for CCNA_00876 in Caulobacter crescentus NA1000

Annotation: 7,8-dihydro-8-oxoguanine-triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00586: mutator mutT protein" amino acids 7 to 131 (125 residues), 106 bits, see alignment E=7e-35 PF00293: NUDIX" amino acids 8 to 130 (123 residues), 88.1 bits, see alignment E=5.2e-29 PF14815: NUDIX_4" amino acids 10 to 128 (119 residues), 97.9 bits, see alignment E=3.3e-32

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to ccs:CCNA_00876)

Predicted SEED Role

"5-methyl-dCTP pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C810 at UniProt or InterPro

Protein Sequence (134 amino acids)

>CCNA_00876 7,8-dihydro-8-oxoguanine-triphosphatase (Caulobacter crescentus NA1000)
MTKPIVLVAAAALIDVDGRVLICQRPQGKQLAGLWEFPGGKVEAGETPEQCLIRELQEEL
GIKVAQACLAPFVFASHSYESFHLLMPLYLLRRWEGQVTRKEHEALAWVKPDKLSDYPMP
PADEPLVAWLRDVL