Protein Info for CCNA_00864 in Caulobacter crescentus NA1000

Updated annotation (from data): D-xylose 1-dehydrogenase (EC 1.1.1.175)
Rationale: Specifically important for utilizing D-Xylose. Automated validation from mutant phenotype: the predicted function (1.1.1.175) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: xylose dehydrogenase xylB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 12 to 198 (187 residues), 148.6 bits, see alignment E=2.4e-47 PF01370: Epimerase" amino acids 14 to 124 (111 residues), 24.1 bits, see alignment E=3.3e-09 PF13561: adh_short_C2" amino acids 21 to 247 (227 residues), 168.2 bits, see alignment E=3.7e-53

Best Hits

Swiss-Prot: 100% identical to XDH_CAUVN: D-xylose 1-dehydrogenase (xylB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0821)

Predicted SEED Role

"D-xylose 1-dehydrogenase (EC 1.1.1.175)" in subsystem Xylose utilization (EC 1.1.1.175)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.175

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H1Z0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>CCNA_00864 D-xylose 1-dehydrogenase (EC 1.1.1.175) (Caulobacter crescentus NA1000)
MSSAIYPSLKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPI
PPVYKRCDLMNLEAIKAVFAEIGDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLRHML
FCTQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIR
VTCVVPGNVKTKRQEKWYTPEGEAQIVAAQCLKGRIVPENVAALVLFLASDDASLCTGHE
YWIDAGWR