Protein Info for CCNA_00794 in Caulobacter crescentus NA1000

Annotation: conserved membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 56 to 82 (27 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details PF03739: LptF_LptG" amino acids 9 to 359 (351 residues), 230.9 bits, see alignment E=1.2e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0757)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6B1 at UniProt or InterPro

Protein Sequence (397 amino acids)

>CCNA_00794 conserved membrane spanning protein (Caulobacter crescentus NA1000)
MIFPNTLDRYLLRRTLAPMSAVLISTMVAFLMERLMRSFDLLSQTTEGLRYLAELLVNLT
PHYVGLTLPGGFFIGLFVVVNGLNKSSEIDAILASGTSLTRFTAPFVAMGVLLMVLSVIL
FGFVQPYSRYAYHAVLHAAENAGWNGDVRPKALLSAGSDFFLTADRTDASGRYLQQVFIR
RIDPNGREDILTAVSAVVHKNPADSHIALELTNGRQISTVAGAQSYVVNFSRLMFDVPSG
DAGLLRLRGEDVSELTLIELARQGFGLEPAALPRETLLAALYARLARALILPLLPLIAVP
FGLSAKRAGSGAAVAAGGVLLFAFEILMVLGQATAPRVTALVAIALPAAIFAAICIATFG
VSQRRPGENPVSWFIEQVAAVAQAVIKTVRRQPALPR