Protein Info for CCNA_00689 in Caulobacter crescentus NA1000

Annotation: PAS-family hybrid histidine kinase/receiver protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 TIGR00229: PAS domain S-box protein" amino acids 13 to 137 (125 residues), 77.4 bits, see alignment E=5.1e-26 amino acids 156 to 273 (118 residues), 39.6 bits, see alignment E=2.5e-14 amino acids 275 to 397 (123 residues), 64.4 bits, see alignment E=5.4e-22 PF00989: PAS" amino acids 19 to 128 (110 residues), 33.8 bits, see alignment E=1.4e-11 amino acids 280 to 331 (52 residues), 26.5 bits, see alignment 2.5e-09 PF08448: PAS_4" amino acids 40 to 132 (93 residues), 29.1 bits, see alignment E=4.4e-10 PF08447: PAS_3" amino acids 41 to 124 (84 residues), 67.2 bits, see alignment E=5.7e-22 amino acids 173 to 259 (87 residues), 47.9 bits, see alignment E=6e-16 amino acids 300 to 370 (71 residues), 45 bits, see alignment E=4.8e-15 PF13426: PAS_9" amino acids 41 to 129 (89 residues), 27.8 bits, see alignment E=1.2e-09 amino acids 290 to 389 (100 residues), 28.7 bits, see alignment E=5.9e-10 PF00512: HisKA" amino acids 410 to 476 (67 residues), 66.1 bits, see alignment E=1.1e-21 PF02518: HATPase_c" amino acids 524 to 634 (111 residues), 100.8 bits, see alignment E=2.9e-32 PF00072: Response_reg" amino acids 660 to 767 (108 residues), 64.5 bits, see alignment E=4.3e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00689)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6D3 at UniProt or InterPro

Protein Sequence (776 amino acids)

>CCNA_00689 PAS-family hybrid histidine kinase/receiver protein (Caulobacter crescentus NA1000)
MPTPFPQDIDALRASEAFFRLLTEQAGDVISRHRLSGTDHYVSPAVERMMGWTAEEMLEA
GFKAFYHPDDTPAVYDVYNRMRAGVEHCSVRYRGRRKDGRYVWLESHLTLVRDEAGAPSE
LIAVTRDIDERVQLEDEARHTREAMRETQQRAMLAEQVAQVAFWRVDLITNEVYLSPRFR
ELYGWTQDEPISLGEVLSRFHPEDRPVARARVAEHLRTGEPSRNRMDRIIRLDGAVRHIV
GSFEFDFDDNGRPIAMSGTTVDVTDLVAAQQSLAKTESRFQDLAKATRDIVIEVDRRGNI
LFVSAAVEPVLGYAEGELLGRKAAKLTHPNDLPGLVQAFGAVLADPEGLPPVLEARALHK
DGHWVWLQGRPVLNRTAGRIEGVIQDITEYKRARDELAAEQARAEQALEARSAFLANMSH
ELRTPLTAVIGFAALVEGLDDLPETARDYVGRISTAGKALLSVINDVLEMSKLETGQVQA
HLAPCALAPLIDDTVRMFGLHAAEKNLQIAVRMVDPPPRVLMIDPDRVRQVLINLIGNAI
RYTDAGSITLEVIWRGELEELFVAVKDTGIGIDPADQAHLFKRFSQIESARARSRGGSGL
GLVISKGLVEAMGGRIGASSKPGEGSTFWFAIPASGPLRDEDAGPEPEPVFEPVRSGGRI
LLADDNALNREMTRAILGVFDAEVVEARDGQQAVEAARDQAFDLILMDIRMPVLDGLDAT
RAIRAEPGPNQGAPILAFSADMDFQLSEIFDGLVRKPITAAQLIQAVAGAQRAVAI