Protein Info for CCNA_00670 in Caulobacter crescentus NA1000

Annotation: ABC-type polysaccharide/polyol phosphate transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00005: ABC_tran" amino acids 50 to 182 (133 residues), 77 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 100% identity to ccs:CCNA_00670)

MetaCyc: 43% identical to O antigen ABC transporter ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-125 [EC: 7.5.2.14]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5B4 at UniProt or InterPro

Protein Sequence (250 amino acids)

>CCNA_00670 ABC-type polysaccharide/polyol phosphate transport system, ATPase component (Caulobacter crescentus NA1000)
MTHQIKLTNVDLDYFVYSLRSQSLRSAVFNLAVGGRMYKAAGDVAAVKALHDINLEINEG
DRIALVGHNGSGKTTLLKVIAGIYSPTRGELSIDGDITSMIAINAGLDMEATGLRNIHKL
GLMRRLSRKVIDSRVDAIAEFSGLGDFLHLPVRTYSAGMLARLMFTVATEFEADILVLDE
WLSAGDAAFVQKAAQRMHRMVEDAKIVVMATHDHDLVQRVCNRVCELQGGKIAFLGSTED
WLAYRETQAA