Protein Info for CCNA_00602 in Caulobacter crescentus NA1000

Annotation: von Willebrand factor type A domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 8 to 28 (21 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details PF01882: DUF58" amino acids 198 to 370 (173 residues), 74.4 bits, see alignment E=1.3e-24 PF13519: VWA_2" amino acids 234 to 339 (106 residues), 28.2 bits, see alignment E=3.7e-10 PF05762: VWA_CoxE" amino acids 257 to 381 (125 residues), 27.3 bits, see alignment E=3.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00602)

Predicted SEED Role

"Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C444 at UniProt or InterPro

Protein Sequence (437 amino acids)

>CCNA_00602 von Willebrand factor type A domain protein (Caulobacter crescentus NA1000)
MIYPTRRAVIAMAAGLPPALLVGVLAPAGWLTGLAWIGLVALFLVVDALSAASRGGLTLE
PTETRIFSVARAGQARFVANFAPARRPSRAFAALEADERLGLETAFVDVEVEAGVARFAF
PLTPERRGSGKLARLWVRWTGPLGLAWKQKAFDLDVEAVVGTDLAGVREEAVKMLARDAA
IGAKTQIERGEGSEFEALREFRLGMDRRAIDWKQSARHMQLLAKEFRTERNHQVVMAMDC
GRAMCEPVGGAPRIDRAIHAALLLALACLRSGDRAGFFAFDSAPRLLTGVVGGADAFGQL
QQAAARIDYSTEETNYTLALSHLAAKLGRRSLVVVFTDFTDPTAAELMIEASARLLSRHL
VLFVVMQDEELEAMVATDPAEPADVTRAVVAAGLMREREVVIARLRRLGAHIVEAPAARI
GPALINAYVDLMRRELL