Protein Info for CCNA_00543 in Caulobacter crescentus NA1000

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR01848: polyhydroxyalkanoate synthesis repressor PhaR" amino acids 22 to 130 (109 residues), 167.5 bits, see alignment E=4.9e-54 PF07879: PHB_acc_N" amino acids 23 to 83 (61 residues), 103.7 bits, see alignment E=4.4e-34 PF05233: PHB_acc" amino acids 89 to 128 (40 residues), 64.7 bits, see alignment 6.3e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00543)

Predicted SEED Role

"PhbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4X3 at UniProt or InterPro

Protein Sequence (216 amino acids)

>CCNA_00543 methyl-accepting chemotaxis protein (Caulobacter crescentus NA1000)
MSENPEKGETTAGGEKSSGQRVIIKKYANRRLYNTASSSYVTLEHLSDMVKEGVDFVVYD
AKTNDDITRSVLTQIIFEEENRGGGQNLLPIQFLRQLIGFYGNSMQAFLPSYLEMSLESF
AKQQERLRGQLSTMAPGKMPGMGVYEEQIRQNMALFDRAMKMFSPFAYVRPEDAAAAPAE
PAPAPAPAPPSDDSLADLKRQLEAMQEQIAKLASKS