Protein Info for CCNA_00525 in Caulobacter crescentus NA1000

Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 13 to 289 (277 residues), 220.8 bits, see alignment E=1.2e-69 PF01790: LGT" amino acids 14 to 285 (272 residues), 242.9 bits, see alignment E=1.5e-76

Best Hits

Swiss-Prot: 100% identical to LGT_CAUVN: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to ccr:CC_0492)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZV6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CCNA_00525 prolipoprotein diacylglyceryl transferase (Caulobacter crescentus NA1000)
MIFPNIDPVVHIGPWALQFGPLALRWYALAYVAGILLGWRYALRLTRTASVWGARTPTAT
ALQIDDLVLWITLGIIVGGRLGYFVFYMLMNDDQRAWLAAHPMDVFKIWEGGMSFHGGFL
GVCAAIILFARQQKIDMLRLGDLIAPVAPIGIFFGRIANFINGELWGRVTDGPFGIIFCN
ETIQANHPQRICPAGPLPRHPSQLYEAALEGLVLFLILAFAIYRLKWLRRRGALVATFLL
GYGLARLALENVRNPDVGMPEFPLGLTMGMMLSIPMILAGGWLLWKSLKEPIRDDAEAHE
PA