Protein Info for CCNA_00520 in Caulobacter crescentus NA1000

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF13793: Pribosyltran_N" amino acids 1 to 117 (117 residues), 171.3 bits, see alignment E=9.5e-55 TIGR01251: ribose-phosphate diphosphokinase" amino acids 1 to 312 (312 residues), 379.7 bits, see alignment E=4.2e-118 PF00156: Pribosyltran" amino acids 148 to 265 (118 residues), 67.5 bits, see alignment E=1.3e-22 PF14572: Pribosyl_synth" amino acids 201 to 311 (111 residues), 88 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 100% identical to KPRS_CAUVN: Ribose-phosphate pyrophosphokinase (prs) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 100% identity to ccs:CCNA_00520)

MetaCyc: 48% identical to Ribose-phosphate pyrophosphokinase 1 (Homo sapiens)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZV1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>CCNA_00520 ribose-phosphate pyrophosphokinase (Caulobacter crescentus NA1000)
MKLLSGNSNRPLSQAIAEYLDMPLTRAQVRRFADLEVFVTIDENVRGEDVFVIQSTSYPA
NDNLMELLICIDALKRASGKRITAVIPYFGYARQDRKTGGRTPISAKLVANLITRSGADR
VLTMDLHAGQIQGFFDIPTDNLLPSRLMAEDIRRHYPMGDDLMVVSPDVGGVVRARALAK
RLDDADLAIVDKRRSGPGQSEVMNIIGDVKDRRCILFDDIADSAGTLCNAAQALMAHGAK
SVSAYITHGVLSGAAADRVANSVLTELVVTDSIEASDPAKACPKIRYVSCAPLIGEAIRR
IANEESVSKLFD