Protein Info for CCNA_00467 in Caulobacter crescentus NA1000

Annotation: oligosaccharide translocase/flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 231 to 245 (15 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 381 to 381 (1 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 5 to 272 (268 residues), 154 bits, see alignment E=5.8e-49 PF13440: Polysacc_synt_3" amino acids 28 to 323 (296 residues), 51.1 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 100% identity to ccs:CCNA_00467)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5Y2 at UniProt or InterPro

Protein Sequence (423 amino acids)

>CCNA_00467 oligosaccharide translocase/flippase (Caulobacter crescentus NA1000)
MKSIRANILALYVWQAAQYAIPILTIPVLAHSLGVAGFGDVAVALNFAMYFTVVTEWGFN
LSATQQVARAADSREELRHIFWNTVLARVMLAAVCLIAAAILPIVVPALGRVSTLIWIAS
IQVVGTAITTNWFLQGLEKMGTFSTISIIGRIVVIPLTFIFVRGPDDAWVAVAIQTGSVL
LIGACGFIISLNLRPLLPIHFAPRGALAKISEGVHLFSSQAAVTMYAQTNVVILGILSGS
AAAGIFNGGDRIRRAAQAAIGPISTALYPRVSVLALTDPAAAFKLIRRALIAQGGLSLCV
SIAIFVFADLVVNVLLGKEFGEAATILRILSPVPLLVGINNVLGTQILLPFGKAKTFSTI
IIVCGLFNIVSLVALCPRLGAVGAASSIVMTEALVTGAMAIFALSVALSVKGRRIPPPQA
PGA