Protein Info for CCNA_00436 in Caulobacter crescentus NA1000

Annotation: acyl-CoA dehydrogenase, short-chain specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF02771: Acyl-CoA_dh_N" amino acids 6 to 116 (111 residues), 111.6 bits, see alignment E=5.7e-36 PF02770: Acyl-CoA_dh_M" amino acids 121 to 217 (97 residues), 99.2 bits, see alignment E=2.5e-32 PF00441: Acyl-CoA_dh_1" amino acids 229 to 376 (148 residues), 163.6 bits, see alignment E=7.4e-52 PF08028: Acyl-CoA_dh_2" amino acids 245 to 366 (122 residues), 86.1 bits, see alignment E=5.3e-28

Best Hits

Swiss-Prot: 42% identical to ACDC_BACSU: Probable acyl-CoA dehydrogenase YngJ (yngJ) from Bacillus subtilis (strain 168)

KEGG orthology group: K06446, acyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 100% identity to ccs:CCNA_00436)

MetaCyc: 57% identical to medium-chain acyl-CoA dehydrogenase (Cupriavidus necator H16)
RXN-22997 [EC: 1.3.8.7]

Predicted SEED Role

"Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)" in subsystem Isoleucine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4N6 at UniProt or InterPro

Protein Sequence (382 amino acids)

>CCNA_00436 acyl-CoA dehydrogenase, short-chain specific (Caulobacter crescentus NA1000)
MALDLETREQLIDTVARFVAERLRPIEAQVAENDAVPDDVIEEMKGLGLFGLTIPEEFGG
LGLTMEEEALVAIELGRASPAFRSVFGTNVGIGSQGLVMFGNDEQKAKWLPGIASGAVIT
SFALTEPEAGSDSAAVQTRATRDGDDYILNGSKRYITNAGKASLFTVMARTNPDAKGGAG
VSAFLVPRDLPGLTVGKPEKKMGQQGAHIHDVTFDNVRVPAWNRLGAEGEGFKVAMQVLD
RGRLHIAAVCVGVAERLIADCVAYASERKQFGQPIASFQLIQAMIADSKTEALAAKALVL
ETARKRDAGVNVTLEAASSKLFASEMVGRVADRAVQVFGGAGYVADYGIERLYRDVRIFR
IYEGTSQVQQLIIARETLKRGG