Protein Info for CCNA_00370 in Caulobacter crescentus NA1000

Annotation: ATP synthase B chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05405: Mt_ATP-synt_B
  • amino acids 11 to 121 (111 residues), 22.2 bits, E=9.5e-09
• PF00430: ATP-synt_B
  • amino acids 14 to 144 (131 residues), 73.7 bits, E=1.5e-24

Best Hits

Swiss-Prot: 100% identical to ATPF_CAUVC: ATP synthase subunit b (atpF) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 100% identity to ccr:CC_0365)

Predicted SEED Role

"ATP synthase F0 sector subunit b (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See A0A0H3C6N6 at UniProt or InterPro

Protein Sequence (169 amino acids)

>CCNA_00370 ATP synthase B chain (Caulobacter crescentus NA1000)
MEHQSLFSFSNPEFWVLAALVIFFGLLVVLKVLPGALFGALDGYAAKIKAELDEAQQLRE
EAQALLADVKAQREDAERQAAAMLEAAKADAKRLAEEAKEKLEEQIKRRAEMAERKIAQA
EAQAAADVKAAAVDLAAQAAETVLAARLAGAKGDTLVDAAIGQMGAKLQ