Protein Info for CCNA_00365 in Caulobacter crescentus NA1000

Annotation: ornithine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02784: Orn_Arg_deC_N
  • amino acids 34 to 262 (229 residues), 142.4 bits, E=1.7e-45
• PF00278: Orn_DAP_Arg_deC
  • amino acids 213 to 349 (137 residues), 29.5 bits, E=7.2e-11

Best Hits

KEGG orthology group: K01581, ornithine decarboxylase [EC: 4.1.1.17] (inferred from 100% identity to ccs:CCNA_00365)

Predicted SEED Role

"Ornithine decarboxylase (EC 4.1.1.17) / Arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.17, EC 4.1.1.19)

MetaCyc Pathways

• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• arginine dependent acid resistance (1/1 steps found)
• cadaverine biosynthesis (1/1 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (1/2 steps found)
• putrescine biosynthesis I (1/2 steps found)
• putrescine biosynthesis III (1/2 steps found)
• superpathway of ornithine degradation (5/8 steps found)
• superpathway of putrescine biosynthesis (2/4 steps found)
• aminopropylcadaverine biosynthesis (1/3 steps found)
• L-lysine degradation X (3/6 steps found)
• superpathway of polyamine biosynthesis II (4/8 steps found)
• spermidine biosynthesis III (1/4 steps found)
• L-lysine degradation I (3/7 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• bisucaberin biosynthesis (1/5 steps found)
• desferrioxamine B biosynthesis (1/5 steps found)
• desferrioxamine E biosynthesis (1/5 steps found)
• lupanine biosynthesis (1/5 steps found)
• superpathway of polyamine biosynthesis I (3/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
• superpathway of L-lysine degradation (8/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutathione metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.17 or 4.1.1.19

Sequence Analysis Tools

See A0A0H3C6N1 at UniProt or InterPro

Protein Sequence (419 amino acids)

>CCNA_00365 ornithine decarboxylase (Caulobacter crescentus NA1000)
MRTYHSPLDLVRERSPERPVALVRPDAVAVAARWFQSEFKGDVFYAVKANPSPWVIRELA
KAGVRSFDVASLNEVELVANEAPGSRMAFMHPVKSRAAISAAYFDHGVKTFSFDTHEELA
KILDATGQAKDLNLIVRMGVQAEGAAYSLSGKFGVEMHNAPDLLLAARRATQDLMGVSFH
VGSQCMRPTAFQAAMAQASRALVRAGVLADVVDVGGGFPSIYPGMVPPDLSEYLAAIDRG
FAEMMVHETTELWCEPGRALVAEASSLLVKVELKKGDALYLNDGSYGSLFDAAHMKWPFP
VKLYRKSGEVVEEGLKPFRFYGPTCDSVDHMPGPFYLPESVDEGDYIEIGMLGAYGVAMN
TRFNGFGETDTAQVQDAPMASMYGLAKRSIPVVRQETEERKIVRFSRPKGAAGKRKRRR