Protein Info for CCNA_00360 in Caulobacter crescentus NA1000

Annotation: alpha/beta hydrolase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF12697: Abhydrolase_6" amino acids 35 to 289 (255 residues), 87.1 bits, see alignment E=5.7e-28 PF12146: Hydrolase_4" amino acids 35 to 176 (142 residues), 57.2 bits, see alignment E=3.3e-19 PF00561: Abhydrolase_1" amino acids 35 to 141 (107 residues), 61.3 bits, see alignment E=2.4e-20 PF00756: Esterase" amino acids 101 to 162 (62 residues), 29.5 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0355)

Predicted SEED Role

"FIG00482611: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6M5 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CCNA_00360 alpha/beta hydrolase superfamily protein (Caulobacter crescentus NA1000)
MDAAVFREPRRRVVAVPGGEIAALEFGPEDRAIDIVFVHANGFNAQTYRTLLSPLAAGLR
VLAIDQRGHGATTLPADPKGRRSWRDLRDDLVGLLDVLDGPPAVLAGHSMGGTVSLLTAA
ERPDRVKGLLLLDPVIMPWLANLYAKAPWTSGRGFLQLPIAQAALKRRAVFDNREAVFAG
YKGRGAFKTWPETMLADYVAGGVVDAPDGKVRLACAPAWEASNYAAQAHDPWRAVRRVTA
PVRILKAQKHSTCRAGDGFARRGRDVRIETIEGTSHFLPMERPDLVRDALFEMATA