Protein Info for CCNA_00321 in Caulobacter crescentus NA1000

Annotation: LSU ribosomal protein L21P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00829: Ribosomal_L21p" amino acids 1 to 101 (101 residues), 113.4 bits, see alignment E=2.5e-37 TIGR00061: ribosomal protein bL21" amino acids 2 to 101 (100 residues), 103 bits, see alignment E=4.9e-34

Best Hits

Swiss-Prot: 100% identical to RL21_CAUVC: 50S ribosomal protein L21 (rplU) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 100% identity to ccs:CCNA_00321)

Predicted SEED Role

"LSU ribosomal protein L21p / domain of unknown function" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5M1 at UniProt or InterPro

Protein Sequence (171 amino acids)

>CCNA_00321 LSU ribosomal protein L21P (Caulobacter crescentus NA1000)
MYAVIKTGGKQYRVQAGDLLVVEKLEGEPGAAVAFGEVLMLGEGEAVTVGAPTVDGAVVS
GTLLETRKGEKVKIFKKIRRQGYRRTRGHRQFESVVRVTSVAGAGKEAKWEGTIDLTPKV
ILDARARGLGDAAVPATIPAPVEAAPAKAEAAPKKKAAPKKAAAKTEEGEA