Protein Info for CCNA_00253 in Caulobacter crescentus NA1000

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01296: aspartate-semialdehyde dehydrogenase" amino acids 4 to 331 (328 residues), 453.5 bits, see alignment E=2.2e-140 PF01118: Semialdhyde_dh" amino acids 4 to 117 (114 residues), 118.1 bits, see alignment E=3.1e-38 PF02774: Semialdhyde_dhC" amino acids 138 to 317 (180 residues), 181.2 bits, see alignment E=2.3e-57

Best Hits

Swiss-Prot: 55% identical to DHAS_RICFE: Aspartate-semialdehyde dehydrogenase (asd) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 100% identity to ccs:CCNA_00253)

MetaCyc: 47% identical to aspartate semialdehyde dehydrogenase (Arabidopsis thaliana col)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C356 at UniProt or InterPro

Protein Sequence (342 amino acids)

>CCNA_00253 aspartate-semialdehyde dehydrogenase (Caulobacter crescentus NA1000)
MGYRVAVVGATGNVGREMFNILEEVKFPVDKMHAIASRKSIGVEVSFGNEILKCEDLEQF
DFSKVDLVLMSAGGSISKAWGEKIGAAGPIVIDNSSHFRMDPDVPLVVPEVNPEAVNSIP
KNIIANPNCSTAQLVVALKPLHDEAKIKRVVVSTYQSVSGAGKEGMDELWDQTKGVYVLG
APPPKKFTKQIAFNVIPHIDVFMDDGFTKEEWKMAVETQKILDPAIKLTATCVRVPVMVG
HSESVNVEFESPLDEDEAREILREADGIVVVDKREDGGYITPKESQGEFPVYISRIRKDP
TVENGLAFWCVSDNLRKGAALNAVQIAQLLHDKGLLKRKVLA