Protein Info for CCNA_00191 in Caulobacter crescentus NA1000

Annotation: N-acetylglutamate synthase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF13480: Acetyltransf_6" amino acids 7 to 115 (109 residues), 29.8 bits, see alignment E=1.5e-10 PF00583: Acetyltransf_1" amino acids 47 to 134 (88 residues), 66.2 bits, see alignment E=8.2e-22 PF13508: Acetyltransf_7" amino acids 52 to 135 (84 residues), 57.8 bits, see alignment E=3e-19 PF13673: Acetyltransf_10" amino acids 53 to 136 (84 residues), 45.9 bits, see alignment E=1.4e-15 PF08445: FR47" amino acids 72 to 137 (66 residues), 28.3 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to ccr:CC_0191)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C2Z8 at UniProt or InterPro

Protein Sequence (158 amino acids)

>CCNA_00191 N-acetylglutamate synthase domain protein (Caulobacter crescentus NA1000)
MITLRTTRPGDLGWIIQRHGELYAAEQGWDHRFEGVVAGVVADYVKTHDPAREACWIAEH
DGAPVGSIMLARETDTVGRLRLLLVEPSARGLGVGEALIAACIARAREAGYAEMVLWTQS
ILLPARRLYARFGFVLEDSWDYDGFADGLVSESWRLKL