Protein Info for CCNA_00173 in Caulobacter crescentus NA1000

Annotation: type II secretion pathway protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 TIGR02533: type II secretion system protein E" amino acids 5 to 482 (478 residues), 724.9 bits, see alignment E=2.2e-222 PF22341: GSPE_N1E" amino acids 6 to 67 (62 residues), 47.7 bits, see alignment E=1.4e-16 PF00437: T2SSE" amino acids 104 to 480 (377 residues), 485.5 bits, see alignment E=8.6e-150

Best Hits

Swiss-Prot: 56% identical to GSPE_PSEAE: Type II secretion system protein E (xcpR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 100% identity to ccr:CC_0174)

Predicted SEED Role

"General secretion pathway protein E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4M2 at UniProt or InterPro

Protein Sequence (491 amino acids)

>CCNA_00173 type II secretion pathway protein E (Caulobacter crescentus NA1000)
MTTPMLAYGFAKRNGVVLLSLGERAVIGVREGYDPMALVEIRRAVGAPLAIEPMTAPVFD
RKFSEVYAGAGLATASSADSLDLEGGLGLLLEDMPAAADLLDPQDDAPVIRLINGLIAEA
VRLGASDIHIEPFEKALIVRLRIDGVLTEVLSLSPRIAAMLVSRVKVMAKLDIAEKRVPQ
DGRISLALGGKSLDVRVSTLPARMGERVVMRILDKDQAGLRLSDLGMSPDVLSALETAVR
EPHGIILVTGPTGSGKTTTLYAALAVLNDNSRNILTIEDPVEYAVHGIGQTQVNTKVGMT
FAAGLRAILRQDPDVVMVGEIRDSETAQIAVQASLTGHLVLSTVHTNDAAGAVVRLRDMG
VEPFLLASTLRLVIAQRLVRRLCEHCRTPEPADAATAALVGLPEGEILYRPVGCAHCGHT
GYQGRIGVYEALRVDDHLRRLIGGNASEQEITEAGLDRRLGQEARNYVLAGLTTVEEALR
ITGQGARDGDL