Protein Info for CCNA_00152 in Caulobacter crescentus NA1000

Annotation: winged helix-turn-helix transcription repressor HrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR00331: heat-inducible transcription repressor HrcA" amino acids 20 to 355 (336 residues), 288.1 bits, see alignment E=6.2e-90 PF01628: HrcA" amino acids 119 to 342 (224 residues), 198.1 bits, see alignment E=9.2e-63

Best Hits

Swiss-Prot: 100% identical to HRCA_CAUVN: Heat-inducible transcription repressor HrcA (hrcA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03705, heat-inducible transcriptional repressor (inferred from 100% identity to ccs:CCNA_00152)

Predicted SEED Role

"Heat-inducible transcription repressor HrcA" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GXP3 at UniProt or InterPro

Protein Sequence (358 amino acids)

>CCNA_00152 winged helix-turn-helix transcription repressor HrcA (Caulobacter crescentus NA1000)
MTQLFPGPIVRTPGLAELDARARDIFRRVVESYLETGEPVGSRTISKGGVALSPASIRNT
MQDLAQLGLLDAPHTSAGRMPTHAGLRMFVDGFLEVGDVAEQEKRAIEARLAVKGRSFEE
ALAEASSILSGLAGGAGIVVTPVREGGVKHVEFVPLGGGQVLAVMVFEDGQVENRLMRQA
PGVTPSALQEASNFLNARLRGRTLTEARTEMGGELDAARRQLNETAARLVEDGLAAWSGG
EGDARSLIVRGQANLLADARAREDIDRVRQLFDDLEQKGQLIGLLDDVRDAEGVRIYIGA
ETRLFSLSGSSVIAAPYMTGRQKVLGAIGVIGPARLNYARVIPLVDYTARVLGRMMDG