Protein Info for CCNA_00145 in Caulobacter crescentus NA1000

Annotation: xanthosine triphosphate pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 10 to 198 (189 residues), 157.5 bits, E=1.2e-50
• PF01725: Ham1p_like
  • amino acids 11 to 196 (186 residues), 201.3 bits, E=7.1e-64

Best Hits

Swiss-Prot: 100% identical to IXTPA_CAUVC: dITP/XTP pyrophosphatase (CC_0146) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to ccs:CCNA_00145)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See A0A0H3C2V8 at UniProt or InterPro

Protein Sequence (200 amino acids)

>CCNA_00145 xanthosine triphosphate pyrophosphatase (Caulobacter crescentus NA1000)
MALKLEVGAKLVAATHNPGKVPEIAALLDGRFEIVTAGQLGLPEPDETESTFVGNALLKA
RHAADLSGLPALADDSGLSVTALDGAPGIFSARWAGPGKDFALAMKKVEERLEETASDDR
TAWFTSALAVAWPNGPAVVVEGRVDGTLVFPGRGTRGFGYDPIFVPEGHALTFGEMEPAA
KDAMSHRARAFAKLKAALFD