Protein Info for CCNA_00052 in Caulobacter crescentus NA1000
Annotation: metal-dependent hydrolase/metalloproteinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to YBEY_CAUVN: Endoribonuclease YbeY (ybeY) from Caulobacter vibrioides (strain NA1000 / CB15N)
KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 99% identity to ccr:CC_0054)Predicted SEED Role
"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8GX09 at UniProt or InterPro
Protein Sequence (151 amino acids)
>CCNA_00052 metal-dependent hydrolase/metalloproteinase (Caulobacter crescentus NA1000) MEIEDEAWTTAEADAEALVWRAAQAVLDAHEDIEGQGIVILLTDDDSVQALNRDFRKKDY ATNVLSFPSPPNPEGQIGDIALAYGVCAREAAEQGKPLAHHLQHLVAHGVLHLLGYDHER DDEAEAMEALEREILAGLDVPDPYASDEEGR