Protein Info for CCNA_00022 in Caulobacter crescentus NA1000

Annotation: putative aerobic-type carbon monoxide dehydrogenase, small subunit CoxS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00111: Fer2" amino acids 6 to 58 (53 residues), 33.6 bits, see alignment E=3e-12 PF01799: Fer2_2" amino acids 73 to 143 (71 residues), 109.9 bits, see alignment E=5.5e-36

Best Hits

Swiss-Prot: 49% identical to NICA_PSEPK: Nicotinate dehydrogenase subunit A (nicA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0022)

MetaCyc: 55% identical to 2-deoxy-D-ribose dehydrogenase alpha subunit (Pseudomonas simiae)
1.1.2.M2 [EC: 1.1.2.M2]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.1.2.M2 or 1.3.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C536 at UniProt or InterPro

Protein Sequence (176 amino acids)

>CCNA_00022 putative aerobic-type carbon monoxide dehydrogenase, small subunit CoxS (Caulobacter crescentus NA1000)
MAMTLDINGKPVSVQAAPETPLLWVLRDELGMTGTKFGCGLAQCGACTVHMDGQPIRSCV
TPIEAVGAAKVTTIEGLGGQHPVQQAWVRHDVPQCGYCQSGQIMSACALLAQKPKPSDQD
IDEAMAGNICRCGAYQRIRAAIKDAADFGPPTGEAHADIDEAIVAASGATHRGAGR