Protein Info for CA265_RS25445 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 281 to 308 (28 residues), see Phobius details amino acids 334 to 360 (27 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 242 (222 residues), 120.8 bits, see alignment E=1e-38 PF02687: FtsX" amino acids 289 to 402 (114 residues), 82.6 bits, see alignment E=2.2e-27

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 76% identity to phe:Phep_3610)

Predicted SEED Role

"ABC transporter efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZD79 at UniProt or InterPro

Protein Sequence (409 amino acids)

>CA265_RS25445 ABC transporter (Pedobacter sp. GW460-11-11-14-LB5)
MNYRENIRLALESIKANRLRTMLTALIIAIGLMALVGILTTLDAVKKSMTDAFSSMGANS
FTIRNRGTGIRIGNGKRPKPFKAIRYEDAVKFKDSLNTPATVAVSVFASGGSTIKYGSLK
TNPNINVQGIDENGLASQGLNLSQGRNFSVSEIQLGSNVCIVGGEVVEKLFKDSDPLDKL
INVGNNRFKIVGILEKKGSSMGFSGDRAVYVPLLKAKQINANANPSYTITVMVPSNEMQE
NIIGESTALFRNIRKVKVNETNNFEITKSDAIAQTLFENLAFVAIGGVAIGIITLIGASI
GLMNIMLVSVTERTREIGIRKAIGANPKVIRHQFLIEAVVICLMGGALGIFLGIVLGNLI
SLAMGGAFLIPWLFIIGGFVLCVFVGILSGYYPAKKASKLDPVEALRYE