Protein Info for CA265_RS25430 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: UDP-glucose 4-epimerase GalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 3 to 162 (160 residues), 30.4 bits, E=8.7e-11
• PF08659: KR
  • amino acids 3 to 133 (131 residues), 26.3 bits, E=2.7e-09
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 3 to 336 (334 residues), 395.7 bits, E=6.6e-123
• PF01370: Epimerase
  • amino acids 4 to 265 (262 residues), 180 bits, E=2.1e-56
• PF00106: adh_short
  • amino acids 4 to 109 (106 residues), 33.3 bits, E=1.4e-11
• PF02719: Polysacc_synt_2
  • amino acids 4 to 111 (108 residues), 31.4 bits, E=4.6e-11
• PF01073: 3Beta_HSD
  • amino acids 5 to 253 (249 residues), 41.1 bits, E=4.7e-14
• PF16363: GDP_Man_Dehyd
  • amino acids 5 to 326 (322 residues), 176 bits, E=6e-55

Best Hits

Swiss-Prot: 50% identical to GALE_HAEIN: UDP-glucose 4-epimerase (galE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 74% identity to phe:Phep_3613)

MetaCyc: 44% identical to UDP-glucose 4-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 4-epimerase. [EC: 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• stachyose degradation (6/7 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See A0A1X9ZD46 at UniProt or InterPro

Protein Sequence (340 amino acids)

>CA265_RS25430 UDP-glucose 4-epimerase GalE (Pedobacter sp. GW460-11-11-14-LB5)
MAKILVTGGTGYIGSHTAVELHNAGYEVVIVDNLSNSNIKILTQLHAITGKWFDFHEIDL
QDDRAVQEFAENHTDIDGIIHFAASKAVGESVEQPLKYYKNNFYGLINLLTSFNRKINFV
FSSSCTVYGQPETLPVTEAAPVQKAESPYGNTKQIAEEILAETAAVTPALNIIALRYFNP
VGAHETALIGELPNGVPANLVPFITQSAIGKRGPITVYGDDYDTPDGSAIRDYIHVVDLA
KAHVAAIKKLEEGNPNGNYDVFNIGTGKGSSVLEIIAAFEKVNGEKLDYKIGPRRAGDIV
QIYGDVQKSNNELGWKANLDINEMMRSAWEWEKYIKANPF