Protein Info for CA265_RS25400 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 45 (17 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 174 to 190 (17 residues), see Phobius details PF00487: FA_desaturase" amino acids 21 to 114 (94 residues), 48 bits, see alignment E=7.1e-17 amino acids 119 to 207 (89 residues), 50.2 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: K09836, beta-carotene ketolase (CrtW type) (inferred from 48% identity to sur:STAUR_6754)

MetaCyc: 58% identical to myxocoxanthin ketolase (Algoriphagus sp. KK10202C)
RXN-19179 [EC: 1.14.99.63]

Predicted SEED Role

"Beta-carotene ketolase (EC 1.14.-.-)" in subsystem Carotenoids (EC 1.14.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.- or 1.14.99.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZD48 at UniProt or InterPro

Protein Sequence (208 amino acids)

>CA265_RS25400 fatty acid desaturase (Pedobacter sp. GW460-11-11-14-LB5)
MACWFISLYFLLTWHFAWSNPLVYLMVFVQMHLYTGLFITAHDAMHGTISPHKKVNHFIG
YLSVFLYAGFLYNHLYTKHHQHHRHVHTEEDPDFAPHGFWKWYFRFMLNYVTVIQLVIMA
IAYNVLKIWVDERNLLLFWVLPSLLSTFQLFYFGTYLPHKGEHDNEYHSATLQKNHFVAF
ITCYFFGYHLEHHQKPAMPWWQLHKTKK