Protein Info for CA265_RS25145 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 TIGR00936: adenosylhomocysteinase" amino acids 11 to 430 (420 residues), 634 bits, see alignment E=5.1e-195 PF05221: AdoHcyase" amino acids 11 to 146 (136 residues), 240.5 bits, see alignment E=5.8e-75 amino acids 148 to 437 (290 residues), 212.6 bits, see alignment E=1.9e-66 PF00670: AdoHcyase_NAD" amino acids 197 to 358 (162 residues), 262.8 bits, see alignment E=3.4e-82 PF02826: 2-Hacid_dh_C" amino acids 216 to 306 (91 residues), 33.3 bits, see alignment E=8.1e-12 PF13241: NAD_binding_7" amino acids 217 to 310 (94 residues), 25.3 bits, see alignment E=4.7e-09 PF07991: IlvN" amino acids 217 to 282 (66 residues), 27.5 bits, see alignment E=5.4e-10

Best Hits

Swiss-Prot: 79% identical to SAHH_FLAJ1: Adenosylhomocysteinase (ahcY) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 92% identity to phe:Phep_3674)

MetaCyc: 68% identical to S-adenosylhomocysteine hydrolase subunit (Rattus norvegicus)
ADENOSYLHOMOCYSTEINASE-RXN [EC: 3.13.2.1]

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.13.2.1 or 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZD12 at UniProt or InterPro

Protein Sequence (438 amino acids)

>CA265_RS25145 adenosylhomocysteinase (Pedobacter sp. GW460-11-11-14-LB5)
MSSVETTYIPYKVKDISLAEWGRKEIGLAEAEMPGLMSLRKEFGPTQPLKGARIAGCLHM
TIQTAVLIETLTALGAEVTWSSCNIFSTQDHAAAAIAAAGIQVYAWKGLNEEEFDWCIEQ
TLHFGPEQQPLNMILDDGGDLTNMVFDKYPELIAAIKGLSEETTTGVHRLYERMKNGTLH
LPAINVNDSVTKSKFDNKYGCRESLVDAIRRATDVMMAGKVAVVCGYGDVGKGSAESLSS
QGVRVIVTEIDPICALQAAMEGYEVKKLATAIKEADIVVTTTGNCDIVREQHFRALKDKA
IVCNIGHFDNEIDMAWLNGAYGDTKVEIKPQVDKYTIDGKDVIILAEGRLVNLGCATGHP
SFVMSNSFTNQTLAQLELWTNTAAYENKVYTLPKHLDEKVARLHLEKIGVELDVLDQHQA
DYIGVPVEGPFKADTYRY