Protein Info for CA265_RS25115 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 229 to 256 (28 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 325 to 342 (18 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 5 to 345 (341 residues), 366.8 bits, see alignment E=5.1e-114 PF03741: TerC" amino acids 106 to 309 (204 residues), 182.6 bits, see alignment E=3e-58

Best Hits

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 66% identity to shg:Sph21_1117)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZC05 at UniProt or InterPro

Protein Sequence (351 amino acids)

>CA265_RS25115 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MGNELLFSLGFLLFIALILALDLGLFSRKEHVVSLKQAGIMSLIMVALAIGFYFILLTEG
HQLHGIKDFAHLREIVINHQHHIKLIPDDFEGSLAIYRQNLGLEFLTGYVIEYALSVDNI
FVIVLVFSAFAVEEKYYHRVLFWGILGAIIMRFIFIFVGAALIAKFAWILYLFGAFLVFT
GVKMFFSKDEDDKIDPENHPVVKWASKIFSIHPKYEGKKFFVKINHKTLVTPLFLVLLIV
EFTDLLFAVDSIPAIFAVTKDPYIVFFSNIFAIMGLRSMFFLLVNIIHKFHYLKTGLAVL
LAFIGVKMLGHTYLEKWGFTTEHSLIVILSILVISIVASLAFPKKKVHVKP