Protein Info for CA265_RS25075 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: phenylacetic acid degradation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 111 to 131 (21 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details PF00970: FAD_binding_6" amino acids 15 to 101 (87 residues), 38.1 bits, see alignment E=2.4e-13 PF00175: NAD_binding_1" amino acids 114 to 217 (104 residues), 60.6 bits, see alignment E=3.4e-20 PF00111: Fer2" amino acids 269 to 338 (70 residues), 52.9 bits, see alignment E=4.3e-18

Best Hits

KEGG orthology group: K02613, phenylacetic acid degradation NADH oxidoreductase (inferred from 66% identity to psn:Pedsa_1390)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBU7 at UniProt or InterPro

Protein Sequence (348 amino acids)

>CA265_RS25075 phenylacetic acid degradation protein (Pedobacter sp. GW460-11-11-14-LB5)
MFKLRINKIINQPGDNITFQFEEVDEPYPKYLAGQFISLIFQGKHKEIRRSYSFNSSPDV
DEPLSITVKRVENGEISRFLHHKTSVNDILLAQEPQGMFSYLPDENLERDLFLFAAGVGI
TPLFSILKTALVREKKSLVTLVYSNRSMEDALFYDELSEWQKKYPERLKIVWVFSNSKNL
MTARLNKFYIEKLLKEHLHFDRNDALFYSCGPIIYMDLCRITLLGVGFDIKQIKRETFVL
PEDEVDEDDGSAEKVVDKNTYSVVLNFKGEIYHLDVPWPKRILDVALENKIKLPYSCRGG
VCSTCVANCTKGGVRMDYNEVLTDDELERGRVLVCTGHPTENGTTIAW