Protein Info for CA265_RS24915 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: cysteine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR00435: cysteine--tRNA ligase" amino acids 5 to 485 (481 residues), 431.2 bits, see alignment E=3e-133 PF01406: tRNA-synt_1e" amino acids 18 to 337 (320 residues), 313.4 bits, see alignment E=2.6e-97 PF09190: DALR_2" amino acids 372 to 431 (60 residues), 42.5 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 62% identical to SYC_FLAJ1: Cysteine--tRNA ligase (cysS) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 84% identity to phe:Phep_0485)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBS7 at UniProt or InterPro

Protein Sequence (486 amino acids)

>CA265_RS24915 cysteine--tRNA ligase (Pedobacter sp. GW460-11-11-14-LB5)
MNTGLQLYNTLSRKKELFQPLNAPNVGMYVCGPTVYSDVHLGNCRTFISFDLIFRYLKYA
GYKVRYVRNITDAGHLEGDRDEGDDKFAKRAKLEQLEPMEIVQKYTLGFHDVLRMFNTLP
PSIEPTATGHIIEQIEMIKIIIANGYGYEVDGNVYFDVEKYSKEYNYTILTNRNLEDMLN
NTRELGGQDEKHGRLDFALWIKAKPETLMQWQSPWGMGFPGWHIECSAMSAKYLGAEFDI
HGGGMDLAATHHTNEIAQSEACSHKQPARYWMHTNMLTVNGTRMSKSAGNGFLPLELFTG
DHPLLKKGFSPMTVKFFMLQAHYRSTLDFSNEALDASEKGFRRLMAAIGLLDKLTAAEQS
DFDIDALKEKCIHAMNDDFNSPILIAELFEAVRIINTVYDGKAKISAEALEKLKQLINDF
VFDILGLKDEDAGGNDLNGVLDMVINLRTEAKANKDYATSDRIRIGLQELGIQLKDGKEG
TTWSKA