Protein Info for CA265_RS24775 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01346: FKBP_N" amino acids 52 to 157 (106 residues), 79.4 bits, see alignment E=3.1e-26 PF00254: FKBP_C" amino acids 166 to 252 (87 residues), 107.1 bits, see alignment E=4.7e-35

Best Hits

Swiss-Prot: 40% identical to FKBA_NEIMB: Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K03773, FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC: 5.2.1.8] (inferred from 50% identity to psl:Psta_1971)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCU3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>CA265_RS24775 peptidylprolyl isomerase (Pedobacter sp. GW460-11-11-14-LB5)
MKRIFLAVCLSGIAVASYAQTKTTAKKPVAQKPTTAASKTSSTTAGLKSTLDSTSYAFGT
SIGAGLKTTGLSTLNYEVLLKGLKDAFTGGKVILTQQQAQQCINEALAKASSVKNKAEEA
ANKIKYAPIMKEGQDFLEQNKKRAGVQTTASGLQYEVLTAGSGVKPLATDSVLVHYKGTL
LNGKQFDSSYDRGEPISFPLNQVIKGWTEGVQLMPAGSKYKFFIPYNLAYGERGAGQDIP
PYSTLIFEVELLKVNGK