Protein Info for CA265_RS24760 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF13175: AAA_15" amino acids 1 to 226 (226 residues), 33.1 bits, see alignment E=1.3e-11 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 364 (364 residues), 291.7 bits, see alignment E=4.2e-91 PF13555: AAA_29" amino acids 3 to 54 (52 residues), 30.5 bits, see alignment 6e-11 PF02463: SMC_N" amino acids 3 to 346 (344 residues), 74.7 bits, see alignment E=1.8e-24 PF13476: AAA_23" amino acids 6 to 240 (235 residues), 45.7 bits, see alignment E=3.2e-15

Best Hits

Swiss-Prot: 50% identical to RECF_FLAPJ: DNA replication and repair protein RecF (recF) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 78% identity to phe:Phep_0534)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBQ8 at UniProt or InterPro

Protein Sequence (367 amino acids)

>CA265_RS24760 DNA replication and repair protein RecF (Pedobacter sp. GW460-11-11-14-LB5)
MWLKNITLLNFKNYTDADLHFSETVNVFTGNNGSGKTNMLDAIHYLCLCKSYFNPIDSQQ
IKTNEEVFMIQGDFDRNEKNEKISCGVKRNQKKQFKRNKKEYEKLADHVGLFPVVMVSPY
DVNLIMEGSEERRKFIDNVISQTDAHYLDQLITYNRILLNRNALLKQIAITRKYDPTLLE
ILDEQLVFAGNKIFAIRKAFMDEFIPLFNQYYTYLTENKEIVELNYQSQLNEATFEELLK
KSVEKDRVLERTTTGIHKDELAFVISDMPLKKFGSQGQQKSFLIALKIAQYAYLAKNKGF
KPLLLLDDIFDKLDDNRVQKLMQMVSHHDFGQIFITDTGRERVKSIFEKIEVDVTLFEVD
NGTIQNA