Protein Info for CA265_RS24665 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): maltose transporter MalT
Rationale: Specifically important for maltose utilization.
Original annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 325 to 342 (18 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 397 (377 residues), 104.1 bits, see alignment E=1.2e-33 amino acids 296 to 443 (148 residues), 42.1 bits, see alignment E=8.4e-15 PF12832: MFS_1_like" amino acids 43 to 219 (177 residues), 25.8 bits, see alignment E=8.4e-10 PF13347: MFS_2" amino acids 45 to 372 (328 residues), 43.1 bits, see alignment E=3.2e-15

Best Hits

KEGG orthology group: None (inferred from 52% identity to mtt:Ftrac_0739)

Predicted SEED Role

"Predicted maltose transporter MalT" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCC9 at UniProt or InterPro

Protein Sequence (458 amino acids)

>CA265_RS24665 maltose transporter MalT (Pedobacter sp. GW460-11-11-14-LB5)
MSLKTIFENPKLTLVQIINMSVGFFGIQFGWDLQRANMGRIYENLGANPDQVPLLFLAAP
LTGLLVQPIIGYLSDRTWHPKWGRRRPYFMIGAIVSSIALIFMPHSSVLWMAAGLLWILD
VFGNIAMEPFRAFVTDKLPDSQVNRGFIMQSMMIGLGGSVASALPWIMNNVFHLTNTAEQ
GSIPENVKFSFYIGAFFFFAAVLWTVFTTKEYPPQDVDFKEKVKESNKGFGGGAREIFHA
LRNMPKRMQIVSLVQFFTWPGLFLMWFYYTTAVAVNVFGGKDAADPVYAQGADFGSLTLA
YYSVITFLFALVLPKIADALGRKTTHALCLICGAIGLISVAWVHDKNMLYLCMTGVGIAW
ASILSMPYAMLSGSLPKDKIGIYMGIFNFFIVLPEIIASLGFGWLMRNVLNNDRLLAVQL
GGGLMILAAVICYVFIREPKKTDEVLAAKLGVEENRSV