Protein Info for CA265_RS24355 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF12840: HTH_20" amino acids 11 to 59 (49 residues), 43.9 bits, see alignment E=1.9e-15 PF01022: HTH_5" amino acids 13 to 58 (46 residues), 39.5 bits, see alignment E=4e-14

Best Hits

Swiss-Prot: 37% identical to SDPR_BACSU: Transcriptional repressor SdpR (sdpR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to hhy:Halhy_4087)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCT7 at UniProt or InterPro

Protein Sequence (107 amino acids)

>CA265_RS24355 transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MNLRRDVFQAIADPTRRAILLLVASQSMTAGAIATNFDTARPTVSKHLQILTECELLEQK
QNGREIHYHTNAKKMKEIADFIEPFRKMWDDRFNKLEDIMKNYKPGK