Protein Info for CA265_RS24200 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: fatty acid hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 11 to 136 (126 residues), 42.4 bits, see alignment E=4.7e-15

Best Hits

KEGG orthology group: K02294, beta-carotene hydroxylase [EC: 1.14.13.-] (inferred from 50% identity to fjo:Fjoh_0059)

Predicted SEED Role

"Beta-carotene hydroxylase" in subsystem Carotenoids

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZDC3 at UniProt or InterPro

Protein Sequence (147 amino acids)

>CA265_RS24200 fatty acid hydroxylase (Pedobacter sp. GW460-11-11-14-LB5)
MSVIINIFIVLLTIVSMECLSWFMHKYLFHGPLWSMHKSHHQKAKSFFEWNDLFAVLFAA
LSLFLMYIDRDHFGNRFFIGLGITLYGLIYFVVHDWFVHRRFKTFKSNNAYLQAVRKAHK
IHHKNRGKEKGKAFGLLFVKRGLIKND