Protein Info for CA265_RS24160 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 6 to 263 (258 residues), 315.6 bits, see alignment E=1e-98 PF08543: Phos_pyr_kin" amino acids 13 to 261 (249 residues), 302.7 bits, see alignment E=1.9e-94 PF00294: PfkB" amino acids 106 to 239 (134 residues), 37.6 bits, see alignment E=1.7e-13

Best Hits

Swiss-Prot: 43% identical to THID_STAAS: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Staphylococcus aureus (strain MSSA476)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 55% identity to dfe:Dfer_4828)

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBE9 at UniProt or InterPro

Protein Sequence (272 amino acids)

>CA265_RS24160 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MNYINVLTIAGSDSGGGAGIQADLKTFSALGCFGTSVITAVTAQNTMGVRSVHGIPAGII
KDQLQAVLEDIVPVAIKIGMINRAEVVQVIEKELKTYNQYVPVILDPVMVATSGDRLIEA
DTVTQLVKKLFPLVTLVTPNIDEAIILSGQEIHNLEDMIAAGRKIIEKGAKAVLIKGGHL
IGPIIYDVFMAGKEAPVILESAFIASKNLHGTGCTLSSAIAAEMAKGSSLLAAIKNAKGY
ISQALQTGSEVKTGRGNGPLNHFFEPLKLIIQ