Protein Info for CA265_RS24115 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00702: Hydrolase" amino acids 4 to 182 (179 residues), 95.1 bits, see alignment E=1.5e-30 PF12710: HAD" amino acids 7 to 142 (136 residues), 30.6 bits, see alignment E=9.4e-11 PF13419: HAD_2" amino acids 7 to 187 (181 residues), 107.7 bits, see alignment E=1.6e-34 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 89 to 186 (98 residues), 51 bits, see alignment E=1.8e-17 PF13242: Hydrolase_like" amino acids 144 to 199 (56 residues), 23.7 bits, see alignment E=7.2e-09

Best Hits

KEGG orthology group: None (inferred from 42% identity to zpr:ZPR_0825)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBB8 at UniProt or InterPro

Protein Sequence (221 amino acids)

>CA265_RS24115 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MNKIKAILFDLDGTLIDSEKFHFDCWNKFLCPYGVTLDFKDWLSNYAGIPLPKNAKTIVD
RYKIEEELEGFIDRREKITFDGFRTTDIQLMPFALEFIQFAFEKGLTLAVVTASPKMDVE
AVFERNGLAKYFSLFITRTDVSKSKPDPESYNLCVARLGLEKEECLVFEDTINGVKSALA
AGIACYAIQSNVRAHQKLKIADEIFLSFANAKEFMIQKGLI