Protein Info for CA265_RS23985 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: gliding motility lipoprotein GldB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03514: gliding motility-associated lipoprotein GldB" amino acids 15 to 340 (326 residues), 360 bits, see alignment E=7.1e-112

Best Hits

KEGG orthology group: None (inferred from 67% identity to phe:Phep_0409)

Predicted SEED Role

"GldB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCL2 at UniProt or InterPro

Protein Sequence (344 amino acids)

>CA265_RS23985 gliding motility lipoprotein GldB (Pedobacter sp. GW460-11-11-14-LB5)
MMYNVKHWQIYLIFLFAITFISCRQNNRPDVSNIQLNIKIERFDNELFAGKNKNVIEVDK
QLASKYGMFYYDFIHQILDSKYSNTESLTNLYHDQAYTDLSKEVDSVFPNLKSQEEGLTE
TFKYIKYYYPKAKVPKFISFASGFAYQMPVGDNYLGIGLDMFLGKDSKFYRAIVQSVPLY
LSRRFAPEYIVPRVAETYAHEELFAEPDDNRTLLSKMIFQGKVLYFLDQVLPENLSDSTK
IGYTQQQLEWAQNFEGDIWAYFLENNYLYETDYQKIQVFLSEGPFTPGLGENRDSAPKLG
VWMGWQIVKKYMKSHPDVTLQQLMADNDAQKILNQSKYKPKQQK