Protein Info for CA265_RS23855 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: fumarate hydratase, class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR00979: fumarate hydratase, class II" amino acids 3 to 462 (460 residues), 767.1 bits, see alignment E=2.9e-235 PF00206: Lyase_1" amino acids 11 to 343 (333 residues), 367 bits, see alignment E=9.4e-114 PF10415: FumaraseC_C" amino acids 409 to 461 (53 residues), 93.1 bits, see alignment 1.2e-30

Best Hits

Swiss-Prot: 75% identical to FUMC_PASMU: Fumarate hydratase class II (fumC) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 88% identity to phe:Phep_0160)

MetaCyc: 66% identical to fumarase subunit (Ascaris suum)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZB89 at UniProt or InterPro

Protein Sequence (465 amino acids)

>CA265_RS23855 fumarate hydratase, class II (Pedobacter sp. GW460-11-11-14-LB5)
MSFRIEHDTMGEVQVPADKYWGAQTERSRNNFKIGPEGSMPKEIIHAFGYLKKAAALANT
ELGVLSAEKAGLIAKACDEIIAGQLDDQFPLVIWQTGSGTQSNMNGNEVIANRAHVINGG
SLADDKKVLHPNDDVNKSQSSNDTYPTAMHIAAYKLTVENTIPGLEKLRNTLAQKVEEFS
TIVKTGRTHFMDATPLTLGQEFSGYVQQIDNSIRAIKNALVMVAELALGGTAVGTGLNTP
KGYDVLVAKKIADLTGLPFVTAPNKFEALAAHDAMVELSGALKRTAVALMKVANDVRMLS
SGPRCGIGEIVIPDNEPGSSIMPGKVNPTQPEALTMVCAQVIGNDVAVSVGGMSGHFELN
VFKPLIAANVLQSARLIGDACVSFTDKCAEGITANLPEIEKHLQNSLMLVTALNPHVGYE
NAAKIAKKAHKENKTLKAAAVELGLLTNEQFDEWVRPEDMVGSLK