Protein Info for CA265_RS23450 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: aspartate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF00282: Pyridoxal_deC" amino acids 62 to 403 (342 residues), 143 bits, see alignment E=5.6e-46

Best Hits

KEGG orthology group: None (inferred from 61% identity to fjo:Fjoh_1514)

Predicted SEED Role

"Aromatic-L-amino-acid decarboxylase (EC 4.1.1.28)" in subsystem Aromatic amino acid degradation or Auxin biosynthesis (EC 4.1.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAZ8 at UniProt or InterPro

Protein Sequence (463 amino acids)

>CA265_RS23450 aspartate aminotransferase family protein (Pedobacter sp. GW460-11-11-14-LB5)
MNNLNTDQQNLDAILTTVKQQGIDYLNHIHERPTAGNTEVEIIRDLSDQGSGAIEALKQF
NQRFEPIMVASSGPRYWGFVTGGTTPAAIAGDWLSTIYDQNTQSAKGNGDVSAIIELETI
QLLLSLFNLPKDFFGGFVTGATLSNFTCLAVARQWIGKQFGKDFAREGVSGNVKVLSATP
HSSAIKSLSMLGLGSGNFIQVNVLQGNREALDVSDLELKIQELKGEPFILISSAGTVNTV
DFDDFEAINLLKEKYNFWWHIDAAFGGFAACSPKYSHLLNGWGNADSITVDCHKWLNVPY
ESAVFLVKEKHQLLQVETFQNSNAAYLGNPMENFSYLNFLPENSRRLKALPAWFTLTSYG
KQGYQEIVESNVEVALQFGDFINENPNFGLLAPVRLNTVCFSLTDESLVATFLNKLNESG
KVFMTPTFYNGRKGIRAAFVNWRTSAADVELAIATMLEILTEL