Protein Info for CA265_RS23420 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: peptidase S41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 76 to 362 (287 residues), 264.8 bits, see alignment E=5.1e-83 PF00595: PDZ" amino acids 109 to 165 (57 residues), 23.6 bits, see alignment 1.1e-08 PF13180: PDZ_2" amino acids 110 to 184 (75 residues), 32.5 bits, see alignment E=1.8e-11 PF17820: PDZ_6" amino acids 122 to 150 (29 residues), 28.7 bits, see alignment (E = 1.9e-10) PF03572: Peptidase_S41" amino acids 209 to 362 (154 residues), 176.3 bits, see alignment E=8.1e-56

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 44% identity to shg:Sph21_0376)

Predicted SEED Role

"Carboxy-terminal processing protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCA7 at UniProt or InterPro

Protein Sequence (535 amino acids)

>CA265_RS23420 peptidase S41 (Pedobacter sp. GW460-11-11-14-LB5)
MKKNTRNNILIAVSYSVILIVGMFLGIKFIKDQGFGIKKSPQLASNSDEKLNEILHIING
NYVDDINTDSLQNLPIDSVLHQLDPHSVYLPPTDAQDMTDNLEGNFEGVGIEYYMLNDTM
MVTGVVKDGPAYQAGIKLGDKILSIDTAVVSGRNLPKDQLTGRFKGRSGTGVSVVLLHPG
APQSNRIMVTRGKVNISSIDAAYMINNETGYVRISKFGANTDNDFSAAANNLKARGMKKL
ILDLRDNGGGYFTAATGLADQFLAENKLIVYTQGKHEPRTDYFSTGTGAFQNGKLAVLIN
ENTASASEIVAGAIQDLGRGIIVGRRSFGKGLVQEQFAFGDGSALNLTIARYYTPSGRSI
QKSYKKGYDAYKHELDERMMDGELTGDRTSFQDSIEKAEGVNVQPGRKIKPIGGIQPDVF
VKLDTTGYNKFYSNLVSKKVLSDYVFNVLTNKYSASFVEQNINIFTMNDNDFKDFIGFLQ
RKNVTIDRFQLYNSKNVILNDLKALLCRYYLGDVGYYKAANQTDNAVRQALLNLQ